PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010931441.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 300aa    MW: 34493.7 Da    PI: 6.1681
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010931441.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.61e-52131401128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+v+yL+kkv+ ++l++  +i+evd+yk++Pw+Lp k+  +++ewyfF++rd+ky++g+r+nra+ +gyWkatg dk+v+ k
  XP_010931441.1  13 LPPGFRFHPTDEELIVHYLCKKVTYQPLPV-PIIAEVDLYKYDPWELPDKALFGQREWYFFTPRDRKYPNGSRPNRAAGKGYWKATGADKPVVPK 106
                     79****************************.88***************7777899**************************************98 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++ g+kk Lvfy+g+ap+g+ktdW+mheyrl
  XP_010931441.1 107 gSTRALGIKKALVFYSGKAPRGVKTDWIMHEYRL 140
                     66778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-649165IPR003441NAC domain
PROSITE profilePS5100561.49313165IPR003441NAC domain
PfamPF023654.9E-2714140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGKRRDAEAE LNLPPGFRFH PTDEELIVHY LCKKVTYQPL PVPIIAEVDL YKYDPWELPD  60
KALFGQREWY FFTPRDRKYP NGSRPNRAAG KGYWKATGAD KPVVPKGSTR ALGIKKALVF  120
YSGKAPRGVK TDWIMHEYRL VDKNRATNKG SQRLDEWVLC RLYNKKNSWE KMHQQKEASF  180
GETMDSLDDT GSDSFRTPES DIDNDVVLPD LDDMFQPGAY PSQASNGIQA IRASNTAVYQ  240
PAMEQRQKEE NEWFMDLKLD DLQTSYMAFG STTAPDILNQ DYYSSNLLQP RSNQNDLPPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-9511713174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010931441.10.0PREDICTED: NAC domain-containing protein 68-like isoform X2
SwissprotQ52QH41e-118NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLQ2XQF61e-178Q2XQF6_ELAGV; NAC protein 1
STRINGGSMUA_Achr7P21780_0011e-160(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.11e-85NAC domain containing protein 32